SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017338
Domain Number 1 Region: 42-111
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000314
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 2 Region: 175-220
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000392
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000017338
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000129
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017338
Sequence length 329
Comment (Macaca mulatta)
Sequence
XKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGES
FQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSVKDPM
DDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLHGQKCIVQ
TTSWSQCSKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKS
PEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQS
CKCNYNCPHANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences 9544.ENSMMUP00000017338 ENSMMUP00000017338 ENSMMUP00000017338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]