SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017642
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-23
Family V set domains (antibody variable domain-like) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017642
Sequence length 143
Comment (Macaca mulatta)
Sequence
MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQ
NLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSY
TIQVIKEDLVNEEATGQFRVYRE
Download sequence
Identical sequences ENSMMUP00000017642 ENSMMUP00000017642 9544.ENSMMUP00000017642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]