SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000018083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000018083
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 1.66e-47
Family C-type lysozyme 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000018083
Sequence length 194
Comment (Macaca mulatta)
Sequence
IQDAHLSCQSPTKWSSVSSADSPEKSASGAGTRNLPFQFCLQQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQRVLDDGSIDYGI
FQINSFTWCRHGKLQENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSDWKKGCEVS
Download sequence
Identical sequences ENSMMUP00000018083 ENSMMUP00000036072 9544.ENSMMUP00000018083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]