SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000018148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000018148
Domain Number 1 Region: 334-697
Classification Level Classification E-value
Superfamily SIS domain 4.17e-103
Family double-SIS domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 1-210,265-309
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.05e-49
Family Class II glutamine amidotransferases 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000018148
Sequence length 697
Comment (Macaca mulatta)
Sequence
GIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKK
KGKVKALDEEVHKQQDMDLDIEFDVHFGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIH
NGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNQESQDTSFTTLVERVIQQLE
GAFALVFKSVHFPGQAVGTRRGSPLLIAVRSEHKLSTDHIPILYRTARTQIGSKFTRWGS
QGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAV
VDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRV
NFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDF
LDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHI
NAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMD
DEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVD
KLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCL
QGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSMMUP00000018148 9544.ENSMMUP00000018148 ENSMMUP00000018148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]