SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000018544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000018544
Domain Number 1 Region: 128-305
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-26
Family Pentraxin (pentaxin) 0.0016
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000018544
Domain Number - Region: 631-919
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000357
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number - Region: 58-81
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00927
Family C-type lectin domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000018544
Sequence length 962
Comment (Macaca mulatta)
Sequence
MDTPWGAGERWRHRGAVDRSEISLGPPPIPQVNQGILGPQVAPVAPGEVVETAGGVCKFS
GQRLSWWQAQESCEQQFGHLALQPPDGVLASGLRDLVWVGQREVPLRRPPQRRARTTAVL
VFGEKTADRAARLRSPLPELAALTACAHVQWDCASSDPAALFSVAAPALPNALQLRAFAE
PGGVVRAALVVRGHHAPFLAAFRADGRWHHVCATWEQRGGRWALFSDGRRRAGARGLGAG
HPVPSGSILVLGQDQDSLGGGFSARDAFSGNLTDFHLWARALSPTQLHQAQACAPPPEGL
LFRWDPGALDIAPSLLPMVWVRLLCPVPSEECPTWNPAPRSEGSELCLEPQLFLCCYRTV
WEFRIISELQAWGLCGSPRCTSVSSPVMLLPDPLSEAHGTLSPAEASSFLGLLEHVLAME
MAPLGPATLLAVVRFLKRVVALGAGDPELLLTGPWEQLSQRVVSVASLVLEEQVADAWLS
IREVVGGPMTLVASVQRLAALLSTTMTSEQPRMRIQHRHAGLSGVTVIHSWFTSRVFQHT
LEGLDLQPQAPASSEEANRVQRFLGTQVGSAIISSEVWDITGEVSMAVTFHLQHQAQSPL
FPPHPPSPYTGGAWATTGCSVAALYPDSTACFCNHSTSFAVLLQIYEVQRGPEEESLLRT
LSFVGCGVSFCALTTTFLLFLAAGVPKSERTTVHKNLTFSLACAEGFLMTSEWAKANEVA
CVAVTVAMHFLFLAAFSWMLVEGLLLWRKVVAVSMHPGPGMRLYHATGWGVPVGIVAVTL
AMLPRDYVAPGHCWLNVHTYAIWAFVGPVLFVLTANTCILARVVMVTVSSARRRARMLSP
QPCLQEQIWTQIWATVKPVLVLLPVLGLTWLVGILVHLSPAWAYAAVGLNSIQGLYIFLV
YAACNEEVRSALQRMAEKKVAEVLRTLGMWACAAKEHSLPPSVLPSLPPKSSTPPHPLRA
PA
Download sequence
Identical sequences ENSMMUP00000018544 ENSMMUP00000018544 9544.ENSMMUP00000018544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]