SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000018672 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000018672
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 9 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 623-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 120-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000018672
Sequence length 688
Comment (Macaca mulatta)
Sequence
LFQKLVMFRDVAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSPEK
NTYETKLSQWEMSDRLENCDLEESKSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIF
NQHTYLSQHSRCHSTEKPYKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDS
QLSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTR
HQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRI
HTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGKAFIRGSLLMQHQRIHTGE
KPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQ
CKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKEC
GKSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAF
ARGLLLIQHQRIHTGEKPYQCKECGKAFIRGSQLTQHQRIHTGEKPYECKECGKAFSHGS
QLTLHQRIHTGEKPYECRECRKAFTQSSHLSRHQRIHTGEKPYQCKECGKAFTRGSQLTQ
HQRIHISEKSFEYKECGIDLSRDSQVYM
Download sequence
Identical sequences G7NMV3
ENSMMUP00000018672 9544.ENSMMUP00000018672 ENSMMUP00000018672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]