SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000019006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000019006
Domain Number 1 Region: 70-147
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.62e-19
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 2 Region: 36-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000624
Family Ovomucoid domain III-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000019006
Sequence length 147
Comment (Macaca mulatta)
Sequence
KRKTLLLRLLGVSQAHVHPLQRPTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRC
EFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQC
HSYTGYCWCVTPNGRPISGTAVAHKTP
Download sequence
Identical sequences 9544.ENSMMUP00000019006 ENSMMUP00000019006 ENSMMUP00000019006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]