SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000019192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000019192
Domain Number 1 Region: 15-120,206-368
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.53e-68
Family Pyruvate kinase 0.0000000488
Further Details:      
 
Domain Number 2 Region: 375-506
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.27e-33
Family Pyruvate kinase, C-terminal domain 0.00000502
Further Details:      
 
Domain Number 3 Region: 116-217
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.08e-27
Family Pyruvate kinase beta-barrel domain 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000019192
Sequence length 507
Comment (Macaca mulatta)
Sequence
MSKPHREAGTAFTQTQQLHAVADTFLEHMCRLDIHTPPITAWNTGIICTNSPASRSVEKL
KEMIKSGMNVACLNFSHGTHEYHVETIKNVRTVTEIFASDPILYRPVALALDTKGPEIRT
GLIKDSSTVEVGLKMGATLKIMLDNAYMKKCDENILWLDYKNICKVMEVGSKIYVDDGLI
SLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEEDIQDPKFGVEQDVNMVF
TSFIHKASDVHEVRKALGEKGKNIKVISKIENHSRFDEILEASDGIMVASGDLGIEIPAE
KVFLAQKMMIGWYSRAGKSVINSDVANAVLNAANCIMLSGETAKGDYLEAGRKQHLIAHE
AEAAIYHLQLFEELRLTTITSDPTKATTVGANETSFKCCNGAIIVLTKSGRSAHQVARYR
PRAPIIAVTQNPQTAGQAHLHRGIFPVLCQDPVQEAGAKDVDRWVNLAMNVDNAGSFFKK
GDDVAIALIGWRPGSGFTNTVRVVSVW
Download sequence
Identical sequences ENSMMUP00000019192 ENSMMUP00000019192 9544.ENSMMUP00000019192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]