SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000019467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000019467
Domain Number 1 Region: 172-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 56-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000146
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000019467
Sequence length 270
Comment (Macaca mulatta)
Sequence
MEACLLQLPQRLLLLGAAALTATALETADLADLCGQTWQGDGLLLRSHAASLRFYFVAPD
TDCWLWMQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSPAPAGPCAPGSYLQFYEGPPGA
PRPLGSALCGLTIPVPVASSGPFLGLRLVTRGRQPRVDFVGEGTSFRLGPCGAYFRCQNG
RCIPSSLVCDPWGMDNCGDGSDQGSWPPADCRGPSPVPSETGSTDHHTSSSPTPSPALGS
AGSLRIAAERSPPAGRDPTRQDTALEGYTL
Download sequence
Identical sequences ENSMMUP00000019467 ENSMMUP00000019467 9544.ENSMMUP00000019467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]