SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000020552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000020552
Domain Number 1 Region: 865-1169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000483
Further Details:      
 
Domain Number 2 Region: 1127-1428
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000148
Further Details:      
 
Domain Number 3 Region: 373-572
Classification Level Classification E-value
Superfamily Fibronectin type III 5.88e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 4 Region: 25-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-28
Family MAM domain 0.0000163
Further Details:      
 
Domain Number 5 Region: 271-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000136
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000020552
Sequence length 1433
Comment (Macaca mulatta)
Sequence
MASAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVGWVQSAASLCLEVGQMDVSL
RSEMCLHSASEATSGQGQGSVWGQSLFLGIASGPRSRLRQRKLQAESGHLPRQGWRDISM
TGAFPPPPGALGAGVSQQHRSAPPLPHLLAEPPTPIAPPQLLRAGPTYLIIQLNTNSIIG
DGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPP
LISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHYILGSSHNQ
TIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPGGIAAES
LTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHV
FSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLR
PAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASS
LPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNCIRIARKAACKESK
RPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYSYYPKPVNMTKATV
NYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRSGGVTEASSLLGGS
PRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDK
VKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIATQGPKPEMVYDFW
RMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKITLVKTETLAEYVVRTFALE
RRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTG
CYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDAILEACLCGETTIP
VSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKNRSMDVL
PPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPDFWRLVYDYGCTSI
VMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQEGH
LLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCAC
STVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR
Download sequence
Identical sequences 9544.ENSMMUP00000020552 ENSMMUP00000020551 ENSMMUP00000020552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]