SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000021249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000021249
Domain Number 1 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-27
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-26
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.12e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 9 Region: 184-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 324-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000031
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 492-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000406
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 408-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000248
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000021249
Sequence length 685
Comment (Macaca mulatta)
Sequence
VLLQGTVTFKDVAIDFTQEEWKRLDPAQRNLYRNVMLENYNNLITVGYPFTKPDVIFKLE
QEEEPWVMEEEVLRRHWKGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFAN
VFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNAKCLIRKEHCEYNEPVKSYANSSSHF
VITPFKCNHCGKGFNQTLDLIRHLRIHSGEKPYECSNCKKAFSHKEKLIKHYKIHSREQS
YKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYECN
ECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGK
AFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFSH
KKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNL
IAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLHL
RSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHT
GEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKP
YHCIECGKAFSQKSHLVRHQRIHTH
Download sequence
Identical sequences G7NMV8
ENSMMUP00000021249 9544.ENSMMUP00000021249 ENSMMUP00000021249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]