SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000022014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000022014
Domain Number 1 Region: 130-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000748
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 15-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 4 Region: 168-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000022014
Domain Number - Region: 96-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0196
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000022014
Sequence length 199
Comment (Macaca mulatta)
Sequence
CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHLRYNPCD
LLNNPCRNNSTCLALVDGNQHCICREEFEGKHCEIDVKECLFLSCQDYGDCEDMVNNFRP
GFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPGYHGPFCELEVNKCKISPCLDE
ENCVYRTDRYNCLCAPGYT
Download sequence
Identical sequences 9544.ENSMMUP00000022014 ENSMMUP00000022014 ENSMMUP00000022014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]