SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000022460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000022460
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 213-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 4 Region: 380-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000121
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000022460
Sequence length 488
Comment (Macaca mulatta)
Sequence
MTTSKEAVTFKDVVVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFL
REEKFWMMDIATQREGNSGGKIQPEMKTVPEAGPHEGLSCQQIWEEIASDLTRPQDSTTN
SSQFFEQGDAHSQVEEGLSIMHTGQKPSNHGKCKPSFSDVSIFDLPQQIHSAEKSHSRDE
CGKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRG
FRCRSALTVHCKLHMGEKHYNCEACGRAFIHDIQLQKHQRIHTGEKPFKCEICSMSFRLR
SSLNRHCVVHTGKKPNNTGEYGKGFIGRLDLCKHQTIHTGEKPYNCKECGKSFRRSSYLL
IHQRVHTGEKPYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKR
LHCQKKPFKCEDCGKKLVHRSYRKKLVHRSDQPRDHSGENPSKCEDCGKRYKRRLNLDII
LSLFLNDT
Download sequence
Identical sequences ENSMMUP00000022460 9544.ENSMMUP00000022460 ENSMMUP00000022460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]