SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000022476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000022476
Domain Number 1 Region: 107-154
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 524-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 264-317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 664-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 5 Region: 591-659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 6 Region: 722-793
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000628
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000022476
Domain Number - Region: 30-102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000183
Family TSP-1 type 1 repeat 0.015
Further Details:      
 
Domain Number - Region: 794-848
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000615
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number - Region: 407-469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00183
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 848-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00209
Family TSP-1 type 1 repeat 0.013
Further Details:      
 
Domain Number - Region: 324-405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00824
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 485-523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0942
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000022476
Sequence length 914
Comment (Macaca mulatta)
Sequence
GWTSHLSNCGESNRPPKERSCFRVCDWHSDLFQWEVSDWHHCVLVPYAHSEVKPRTAECV
TAQHGLQHRTVRCIQKLNRTMVANEICEHFAPQPPTEQACLIPCPRDCVVSEFLPWSNCS
EGCGKKLQHRTRAVIAPPLFGGLQCPNLTESRACEAPTSCPLGKEEYTFSLKVGPWSKCR
LPHLKEINPSGRTVLDFNSDSNDRVAFKHQSYKAHHHSKSWAIEIGYQTRQVWCTRXXXX
SFFFSLCMQDSFPLTVQSCIMPKDCETSEWSSWSPCSKTCHSGSLLPGFRSRSRNVKHIA
IGGGKECPELLEKEACIVEGELQQCPRYSWRTSAWKECQVSLLLEQQDPHWHVTGPVCGG
GIQTREVYCTQSVPAAAALRAKEVSRPVEKTLCAGPAPLPSQLCNNPCSTDCIVSSWSAW
GLCIHENCHDPQGKKGFRTRQRHVLMESTGPAGHCPHLVESVPCEDPTCYRWLASEGICF
PDHGKCGLGHRILKAVCQNDHGEEVSGSLCPVPPPPERKACEIPCRMDCVVSEWTEWSSC
SQSCSNKNSDGKQTRSRTILALAGEGGKPCPPSQALQEHRLCNDHSCMQLYWETSPWGPC
SEDTLVTALNATIGWNGEATCGIGIQTRRVFCVKSHVGQVMTKRCPDSTRPETVRPCFLP
CKKDCIVTAFSEWTPCPRMCQAGNATIKQSRYRIIIQEAANGGQECPDTLYEERECEDVS
LCPIYRWKLQKWSPCILVPESVRQGIMGSSEACGKGLQTRAVSCVSDDNQSAEMMDCLKQ
TNGMPPLVQECTVPCREDCTFTAWSKFTACSTNCEATKSRRRQLTGKSRKKEKCQDADLY
PLVETELCPCDEFISQPYGNWSDCILPEGRREPQRGLRVQGDRKECGEGMRFRAVACSDK
NGRPVDPTFCSSSG
Download sequence
Identical sequences 9544.ENSMMUP00000022476 ENSMMUP00000022476 ENSMMUP00000022476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]