SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000022946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000022946
Domain Number 1 Region: 370-488
Classification Level Classification E-value
Superfamily EF-hand 9.12e-32
Family Osteonectin 0.0084
Further Details:      
 
Domain Number 2 Region: 280-351
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 146-218
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.66e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 100-145
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000133
Family Ovomucoid domain III-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000022946
Sequence length 491
Comment (Macaca mulatta)
Sequence
MTVSSARSLCESPPQDRCRLPAAARAPSEGRKEARRAVRPAEPANPARCRLPSLAGTMLP
ARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDGRSY
ESMCEYQRAKCRDQTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGEDGS
FTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTP
TMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSEKVYSCDQERQSALEEARQNPR
EGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKSTEV
DDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERV
VHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPELKG
CLGVSKEGRLV
Download sequence
Identical sequences 9544.ENSMMUP00000022946 XP_005561678.1.63531 XP_011724805.1.29376 XP_014999470.1.72884 ENSMMUP00000022946 ENSMMUP00000022946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]