SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000023115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000023115
Domain Number 1 Region: 80-322
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.55e-93
Family 1,3-glucuronyltransferase 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000023115
Sequence length 323
Comment (Macaca mulatta)
Sequence
MKSVLFTRFFILLPWILIVIIMLDVDTRKPAPPLTPRPYFSPYAVGRGGARLPLRRGGPA
HGTQKRNQSRPQPQPEPQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAA
ARSELVSRFLARAGLPSTHLHVPTPRRYKRPGLPRATEQRNAGLAWLRQRHQHQRAQPGV
LFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPF
AIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWH
TRTEKVNLANEPKYRLDTVKIEV
Download sequence
Identical sequences A0A096MP64 A0A1D5QR23 A0A2K5K3I5 A0A2K5NGE9 A0A2K6EBU9 A0A2K6NK52 G7P301
ENSMMUP00000023115 9544.ENSMMUP00000023115 ENSMMUP00000023115 XP_002803828.1.72884 XP_005552653.1.63531 XP_010369844.1.97406 XP_011735768.1.29376 XP_011812427.1.43180 XP_011922742.1.92194 ENSPANP00000001503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]