SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000023140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000023140
Domain Number 1 Region: 81-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.7e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000642
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000023140
Sequence length 222
Comment (Macaca mulatta)
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIESAEDLEKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDVKSLEKVRKIFRL
Download sequence
Identical sequences ENSMMUP00000023140 ENSMMUP00000027613 9544.ENSMMUP00000023140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]