SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000023825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000023825
Domain Number 1 Region: 115-360
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.39e-71
Family Nuclear receptor ligand-binding domain 0.000000000552
Further Details:      
 
Domain Number 2 Region: 18-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-28
Family Nuclear receptor 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000023825
Sequence length 361
Comment (Macaca mulatta)
Sequence
VTATPTPDVMASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAG
SCEVSKIQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPMQLSNEQE
ELIQTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADVNTFMVQQ
VIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDAAR
VSPAVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRHEIDQLQEE
MALTLQSYIKGQQQRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEIC
S
Download sequence
Identical sequences 9544.ENSMMUP00000023825 ENSMMUP00000023825 ENSMMUP00000023825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]