SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000023999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000023999
Domain Number 1 Region: 89-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-16
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 132-177
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.5e-16
Family LIM domain 0.00037
Further Details:      
 
Domain Number 3 Region: 8-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000013
Family LIM domain 0.0024
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000023999
Domain Number - Region: 35-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0936
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000023999
Sequence length 180
Comment (Macaca mulatta)
Sequence
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTIGSSIPEFHCSC
LVYLKGPCGNSCLLSFPLSTSVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKII
GAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Download sequence
Identical sequences 9544.ENSMMUP00000023999 ENSMMUP00000023999 ENSMMUP00000023999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]