SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024088
Domain Number 1 Region: 87-299
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.02e-63
Family Fibrinogen C-terminal domain-like 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024088
Sequence length 299
Comment (Macaca mulatta)
Sequence
MGLRWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
PQGQPGPPGKMGPKGEPGDPANLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
CDMDTEEGGWLVFQRRQDGSVDFFRPWSSYKAGFGNQESEFWLGNENLHQLTLQGTWSLG
VTLSDPAQTTWPLDSHGIISPKVPGMVLGTKVLSIPSLPGDSLSFHSGRPFTTYDADHDS
SGSNCAVIVHGAWWYASCYRSNLNGRYAMSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Download sequence
Identical sequences 9544.ENSMMUP00000024088 ENSMMUP00000024088 ENSMMUP00000024088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]