SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024270
Domain Number 1 Region: 876-1094
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-41
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1257-1452
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-29
Family Pleckstrin-homology domain (PH domain) 0.0000896
Further Details:      
 
Domain Number 3 Region: 1081-1198
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-23
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024270
Sequence length 1454
Comment (Macaca mulatta)
Sequence
MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLLCVDRGLDEGPRSIPKCSESE
TDEDYIVVPRAPLREDEPKDGGSVGNEALMSPEASGEEEEEREAGGEACGLDGAGAGEDL
VAPAAPGAGVLSREGEEGTDLAPEDEGEGCADEPGTQEQVSGSEEEEKLVQPHRECSLED
GDSWAGEAVFQSDLLPHIHGEEHEPPDTPGEAEEDDGEGCASTDPAGADEGLDSDRPTED
MGQDAEEASEEPPEKEEPATGIQEAETATDGPEVLEEGCEEAMGVTGGEQVDLGEPPDHE
EETNQEVAAATQEDHSQDEPTEESCQIIPFENDCTEDFVTSLTGSPYEFFPTESTSFCSK
SCSPLSESAEGLESEQAPKSGLCAEENPVVGPSCGSVQGGAAAPDVVVVLEEEALDDALA
NPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEEMNCESEGGLVSADRKNTSTRTRPHSG
KVAGYVPETVPEETGPEAGSSVPGIGGATEEVGKTLLSLEGKPLEASRALPAKPRAFTLY
PRSFSVEGREIPVSVYQDPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNHLPSSGTS
TPSSMVDIPPPFDLACITKKPITKSSPSLLIESDSPDKCRRRSSFKRFLALTLRRTENKL
HVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPSSLIFYRDGK
RKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQI
PPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNTFESKQQSADQDVESAYTEPYK
VCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSLTHKVEGQSRALVIAQELLSSEKAYVE
MLQHLHLDFHGAVMRALDDIDHEGRDTLAREELRQGLSELPAIHDLHQGILEELEERLSN
WESQQKVADIFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVREFEQSVQGGS
QTVKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDRANDSMEQGE
NLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLLYTYPQKDG
KYRLKNTLAVASMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPED
YKAQALAAFHHSVEVNGGVAPVLGALAPPTPLPCSHPISCSGMQVSFARTERGENHLGLQ
IVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRTVPGLMRERPVSMSFPLSAPRFSG
SAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHWKKLWFVIKG
KVLYTYMASEDKVAMESMPLLGFTIAPEKEEGSSSEVGPIFHLYHKKTLFYSFKAEDTNS
AQRWIEVMEDASVL
Download sequence
Identical sequences ENSMMUP00000024270 9544.ENSMMUP00000024270 ENSMMUP00000024270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]