SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024354
Domain Number 1 Region: 1193-1348,1390-1466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-38
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1516-1712,1740-1765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-38
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 127-272,342-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 746-893,927-974
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000024354
Domain Number - Region: 1773-1819
Classification Level Classification E-value
Superfamily EF-hand 0.00254
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024354
Sequence length 1989
Comment (Macaca mulatta)
Sequence
MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP
FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISI
KILRQNTTLFSMLIMCTILTNCIFMTMSNPPDWTKNVEYTFTGIYTFESLVKILARGFCV
GEFTFLRDPWNWLDFIVIVFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCVQNSLVNNETLESIMNTLESEED
FRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCMKIGRNPDYGYTSFDTFSWAFLALFRLM
TQDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQ
KELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRN
RRKKKNQKKLSSGEEKGDAEKLSKSDSEENIRRKSFHLGVEGHRRAHEKRLSTPSQSPLS
IRGSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERR
SSNISQASRSPPILPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDS
GTTNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFA
HKFLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAI
GNLVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFR
LLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCK
INDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLV
VLNLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKTFSKKP
KISREIRQTEDLNTKKENYISNYTLAEMSKGHNFLKEKDKISGFGSCVDKYLMEDSDGQS
FIHNPSLTVTVPIAPGESDLENMNTEELSSDSDSEYSKVRLNQSSSSECSTVDNPLPGEG
EEAEAEPMNSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFI
VLMILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAW
CWLDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAI
PSIMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQ
NVRWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFV
IFIIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPIPR
PGNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSPYMTDVLYWINVVFIILFT
GECVLKLISLRYYYFTIGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGR
ILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMF
NFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFY
FVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEY
NKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSL
RSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKD
GDRDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDK
GKDSKESKK
Download sequence
Identical sequences 9544.ENSMMUP00000024354 ENSMMUP00000024354 ENSMMUP00000024354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]