SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024369
Domain Number 1 Region: 93-188
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.13e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00000492
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000885
Family Glutathione S-transferase (GST), N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024369
Sequence length 192
Comment (Macaca mulatta)
Sequence
VPPYTVVYFPVRGRCAALRMLLAEQGQSWKEEVVTMETWQEGSLKASCMNWQLKWTGFAS
RGDSETLVSGLGQTGVSGAGRDESRRMIHGGVWQEAGKDDYVKALPGQLKPFETLLSQNQ
GGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVARLSARPKLKAFLASPE
HVNLPINGNGKQ
Download sequence
Identical sequences 9544.ENSMMUP00000024369 ENSMMUP00000024369 ENSMMUP00000024369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]