SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024505
Domain Number 1 Region: 357-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-80
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-47
Family Pleckstrin-homology domain (PH domain) 0.0000302
Further Details:      
 
Domain Number 3 Region: 214-344
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-29
Family SH2 domain 0.0000254
Further Details:      
 
Domain Number 4 Region: 155-240
Classification Level Classification E-value
Superfamily SH3-domain 1.28e-17
Family SH3-domain 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024505
Sequence length 630
Comment (Macaca mulatta)
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEDNSE
EIVVAMYDFQATEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNN
LDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYH
IKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYE
KWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLT
HPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLE
RNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSR
FSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRC
WQEKPEGRPSFEDLLRTIDELVECEETFGR
Download sequence
Identical sequences A0A096NWE2 A0A1D5QNV8 A0A2K5TW50 A0A2K6BQW6
XP_001103213.1.72884 XP_005554902.1.63531 XP_005554903.1.63531 XP_011749479.1.29376 9544.ENSMMUP00000024505 ENSMMUP00000024505 ENSMMUP00000024505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]