SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000024780
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0023
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0511
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0703
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 409-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.093
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024780
Sequence length 1136
Comment (Macaca mulatta)
Sequence
MVISLNSCLSFICLLLCQWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLY
GIKCDKQCPCHLDNTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCRLGTYGINCSSRCGCKNDAVCSPVDGSCTCKAGWHGV
DCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VINADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFV
NLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPVLIPKSSECGYVEMKSPARRDSPYAEINNSTSANKNVYEVEPT
VSVVQGVFSNNGHLTQDPYDLPKNSHIPCHYDLLPVRDSSSSPKQEDSGGSSSSSS
Download sequence
Identical sequences G7MTW4 G7P861
ENSMMUP00000024780 9544.ENSMMUP00000024780 ENSMMUP00000024780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]