SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024800
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.12e-30
Family Phosducin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024800
Sequence length 193
Comment (Macaca mulatta)
Sequence
ELEGHEDECNEEDEHAVELYRQQRLGEWKITKLKNKCGEVLEVSGKDYVQEVTGEGLWVI
LHLYKQGLPLCALINQHLSGLARKFPDVKFIKAISTTTCTPNYPDRNLPTIFVYLEGDIK
PQFIGSMNLTRDKLEWKLSESGASNTDLEENPKKPTEDVLLSSVWHSVLMKRDSDSKNCL
DFFKKEKVGINPF
Download sequence
Identical sequences 9544.ENSMMUP00000024800 ENSMMUP00000024800 ENSMMUP00000024800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]