SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024864
Domain Number 1 Region: 180-194,283-323,378-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-44
Family Nuclear receptor ligand-binding domain 0.0005
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024864
Sequence length 547
Comment (Macaca mulatta)
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSETTRSTGLLDSG
MFVNIHPSGVKTESTVLMTSDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIE
SLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSI
NYTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHI
FKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKT
YPDDTYR
Download sequence
Identical sequences 9544.ENSMMUP00000024864 ENSMMUP00000024864 ENSMMUP00000024864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]