SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024898
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.07e-127
Family Transglutaminase core 0.00000000000946
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily E set domains 5.25e-43
Family Transglutaminase N-terminal domain 0.000000238
Further Details:      
 
Domain Number 3 Region: 470-568
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.33e-31
Family Transglutaminase, two C-terminal domains 0.00000154
Further Details:      
 
Domain Number 4 Region: 586-635
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000000366
Family Transglutaminase, two C-terminal domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024898
Sequence length 637
Comment (Macaca mulatta)
Sequence
VSIDLVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERREYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVSKSINRSL
TVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKHLLNLNLEPFSEK
SIPLCILYEKYRDCLTESNLIKVRALLVEPVARSTAQLGSHLPLTPHALFQILGEPKQKR
KLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEM
Download sequence
Identical sequences 9544.ENSMMUP00000024898 ENSMMUP00000037915 ENSMMUP00000024898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]