SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000025990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000025990
Domain Number 1 Region: 130-196
Classification Level Classification E-value
Superfamily DEK C-terminal domain 1.06e-22
Family DEK C-terminal domain 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000025990
Sequence length 196
Comment (Macaca mulatta)
Sequence
MLVGMKKFFMQPLPKSKKTSSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNK
EESSDDDDKESEEEQPPKKTAKREKPKQKATSKSKKSVKSANVKKADSSTTKKNQNSSKK
ESESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDL
TERKDFIKTTVKELIS
Download sequence
Identical sequences 9544.ENSMMUP00000025990 ENSMMUP00000025990 ENSMMUP00000025990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]