SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000025995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000025995
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.54e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.16e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 431-481
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000602
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000025995
Sequence length 505
Comment (Macaca mulatta)
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLLPPPPPANEERRGGLPPLPPH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVTHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPP
PPGRGGPLPPPPPATGRSGPPPPPPPGAGGPPMPPPPPPPPPPPPSSGNGPAPPLLPPAL
VPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHTSDSQGP
ASFSFLPDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences ENSMMUP00000025995 ENSMMUP00000025995 9544.ENSMMUP00000025995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]