SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000026225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000026225
Domain Number 1 Region: 465-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-81
Family Protein kinases, catalytic subunit 0.000000000174
Further Details:      
 
Domain Number 2 Region: 162-247
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family I set domains 0.0000137
Further Details:      
 
Domain Number 3 Region: 253-355
Classification Level Classification E-value
Superfamily Immunoglobulin 7.86e-19
Family I set domains 0.0000662
Further Details:      
 
Domain Number 4 Region: 48-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000614
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000026225
Sequence length 808
Comment (Macaca mulatta)
Sequence
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKSWISESVEADVRLRLANVSERDGGEYLCRATNFIGVAEKAFWLSVHRPRA
AEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSTPKKGLGSPTVHKISRFP
LKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPL
GEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNI
INLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCA
YQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPV
KWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPAN
CTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTP
SSSSSGDDSVFAHDLLPPAPPSSGGSRT
Download sequence
Identical sequences A0A2K5V1U0
XP_002802213.1.72884 XP_005554345.1.63531 ENSMMUP00000026225 9544.ENSMMUP00000026225 ENSMMUP00000026226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]