SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000026250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000026250
Domain Number 1 Region: 1360-1603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-36
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1050-1198,1231-1311
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 3 Region: 573-812
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 4 Region: 129-280,334-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.61e-17
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000026250
Sequence length 1786
Comment (Macaca mulatta)
Sequence
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKDKSKDKTGEVPHLRPQLDLKASR
KLPNLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNKKRTIYRFSAKRALFIFGPFNSIRS
LAIRVSGRFTFLMFIIGTVIINCVFMARGPAKNSNSNDTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSCIPGITIKLLSLRTFRVFRALKAISVVSRKS
LSLSTLASRKNKNKVIIHTFFLSSPFPPFYINYTIWPQYLNSRQLESFQTEAVDHCFEKK
ENSTEFKMCGIWMVKSSCSKQYECNHTKSNPDYNYTNFDNFGWSFLAMFRLMTQDSWEKL
YQQTLRTAGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKMFQEA
QQLLKEEKEALVAMGIDRSSLTSLETSYFTPQKRKLFGNKKRKSFFLRESGKGQPPGSDS
DEDSQKKPQLLEQTKRLSQNLSLDHFDEHRDPLQRQRALSAVSILTITMKEQEKSQEPCL
PCGENLASKYLVWNCCPLWLCIKKVLRTVMTDPFTELAITICIIINTVFLAMEHHKMEAS
FEKMLNTGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNIFQKRS
WPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGMQLFGH
SFNSQKSAKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEANASSS
LCVIVFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGQARKTKVQLALDRFRRAFCF
VRHTLEHFCHKWCRKQKLPKQKEVTGGCAAQSKDIIPLVTEMKRGSETQEELGILTSVPK
TLGIRHDRTWLAPLAEEEDDAEFSGEDNAQPITQPEAEQQAYELHQENKKPTSQGVQNVE
IDMFPEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGLLPEMVPEKQPERCLPKGFGC
CFPCCSMDKRKPHWVIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVYLKDRPK
IQELLNCTDIIFTYVFILEMVLKWVAFGFGKYFTSAWCCLDFIIVIVSVTTLINLKELKS
FRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLIFCILGVHFFSGKFG
KCINGTESVISYTIIANKSQCESGNFSWINQKVNFDNVGNAYLALLQVATFKGWMDIIYA
AVDSREKEQQPKFESNSLGYIYFVVFIVFGSFFTLNLFIGVIIDNFNQQQKKISGQDIFM
TEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDVVTSQIFDIIIISLIILNMISMMA
ESYDQSKAVKSTLDHLNWVFVVIFTLECLIKIFALRQYYFTNGWNLFDSVVVLISIVSTM
ISTLESQEYIPFPPTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNIGLLLF
LIMFIYAILGMNWFSKVNPGSGIDDIFNFETFAGSMLCLFQISTSAGWDSLLSPMLRSKE
SCNSSSENCHLPGIATSYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGEDDFDI
FYEVWEKFDPEATQFIEYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSGDRLHCMDI
LFAFTARVLGGSDGLDSMKAMMEEKFMETNPLKKLYEPIVTTTKRKEEERCAAVIQKAFR
KYMMKVTKGDQGDQSDLENRPHSPLQTLCNGDLPSFGVVKGKVHYD
Download sequence
Identical sequences ENSMMUP00000026250 9544.ENSMMUP00000026250 ENSMMUP00000026250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]