SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000026417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000026417
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.33e-55
Family Extradiol dioxygenases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000026417
Sequence length 381
Comment (Macaca mulatta)
Sequence
MAAPALRLCHIAFHVPAGQPLARDLQHLFGFQPLASREVDGWRQLALRSGDAVFLVNEGP
GSGEPLYGLDPRHAVPSATNLCFDVADVGAATRELAALGCSVPVPPVRVRDTQGAATYAV
VSSPAGNISLTLLERAGYRGPFLPGFRPVPSAPGPGWVSRVDHLTLACTAGSSPTLLRWF
HNCLGFCHLPLSPDEDPELGLEITAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTR
QDQVEQFLARHKGPGLQHVGLYTPNIVEATERVAAAGGQFLAPPGAYYQQPGKERQIRAA
GHEPHLLARQGILLDGDEGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQAAKSQEAEGCPELSAAS
Download sequence
Identical sequences XP_001100445.1.72884 ENSMMUP00000026417 ENSMMUP00000026417 9544.ENSMMUP00000026417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]