SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000026916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000026916
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-28
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-25
Family Third domain of FERM 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000026916
Sequence length 419
Comment (Macaca mulatta)
Sequence
DHRARHLYYCHLKERVLRSQCAHREEAYFLLAACALQADLGDHREPAHTGRYFEPHSYFP
QWITTKRGIDYILRHMPALHRERQGLSPKEAVLCFIQEACRLEDVPVHFFRLHKDKKEGH
PTVILGLTLRGVHIYQEVDRAPQLLYDLPWPHIGKLAFLGKKLEIQLDGLPAAQKLVYYT
GCTWRSRHLLHLLRASHQLHLRVRPTLRQLRQREAAEEKQRYRESYISDGLELDPDSRGS
PGSGVSSQHCPHRLSRHSADSHGSSHTSGIEADSWLRESREMSVDTPLEVHGLHEKEPSS
SLRTSRSHPSICGDSQAIRQEPCAEVRTRGQSTEAVHQIWEMKAGVSEEPHSRSLDDTRR
HQLALHPAPTSPSRTFRCAPDCGLTAPCENRATLHSKRSSNCLTLDLFGEAPPPQEFVV
Download sequence
Identical sequences ENSMMUP00000026916 ENSMMUP00000026915 9544.ENSMMUP00000026916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]