SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000027569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000027569
Domain Number 1 Region: 218-342
Classification Level Classification E-value
Superfamily Bromodomain 7.2e-25
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 44-194,221-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000709
Family Extended AAA-ATPase domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000027569
Sequence length 733
Comment (Macaca mulatta)
Sequence
EDENALSIFETHCHSGSPKKQSSAAAIHKPYLHFTMSPYHQPTSYRPRLLLSGERGSGQT
SHLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWW
EAVSETVRATFLTLLQDIPSFSPIFLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIE
EDRRKFFQELILNQASMAPPRRKHAALCAMEVLPLALPSPPRQLSESEKNRMEDQEENTL
RELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLK
DIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKR
GLSVTSEQINPHSTGARKTETRVEEAFRHKQRNPVDVWHNSANKCAFRVRRKSRRRSQWG
KGIIKKRKVNNLKKDEEDTKFADYENHAEDRKLLENGEFEVSTDCHEENGEETGDLSMTN
DESSCDIMDMDQGQRLNNGAGTKENFASTEEESSNESLLVNSSSSLNPEQTSRKETFLKG
NCLNGEASTDSFEGIPVLECQNGKLEVVSFCDSGDKCSSEQKILLEDQSKEKPETSIENH
GDDPEKLEALECSNNEKLEPGPDVEVKDAELDKEGASKVKKYRKLILEQAKTTSLELVPE
EPSEPVPPLIVDRERLKKLLDLLVDKSNNLAVDQLERLYSLLSQCIYRHRKDYDKSQLVE
EMERTVHMFETFL
Download sequence
Identical sequences ENSMMUP00000027569 9544.ENSMMUP00000027569 ENSMMUP00000027569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]