SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000027627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000027627
Domain Number 1 Region: 771-876
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-29
Family Cadherin 0.00054
Further Details:      
 
Domain Number 2 Region: 662-769
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 259-363
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-27
Family Cadherin 0.00046
Further Details:      
 
Domain Number 4 Region: 443-565
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-26
Family Cadherin 0.00066
Further Details:      
 
Domain Number 5 Region: 872-987
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 565-666
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 157-257
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-18
Family Cadherin 0.0042
Further Details:      
 
Domain Number 8 Region: 359-409
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000914
Family Cadherin 0.0031
Further Details:      
 
Domain Number 9 Region: 980-1082
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000286
Family Cadherin 0.01
Further Details:      
 
Domain Number 10 Region: 1248-1281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000027627
Domain Number - Region: 1227-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00055
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000027627
Sequence length 1282
Comment (Macaca mulatta)
Sequence
AGRPLPLQVRLAARGAPTALSRRLRARAHHPGCGARARLCGAFCFPVPGGGAAARLSALA
APTTLPACSCPPRPGPRCPGRPICLPPGSSVRLRLLCALWRAAGSVRVRLEVEAATAGTP
SASPSPSPPLPPNLPQARVGPARRARRGTSGRGSLKFPMPNYQVALFENEPAGTLILQLH
AHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGAVSTDSVLDRETKETHVLRVKAVDY
STPPRSATTYITVLVKDTNDHSPVFEQSEYRERVRENLEVGYEVLTIRASDRDSPVNANL
RYRVLGGAWDVFQLNESSGVVSTRAVLDREEAAEYQLLVEANDQGRNPGPLSATATVYIE
VEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATDRDQGQNAAIHYSILSGXXXXXXX
XXXXXXXXLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSG
ENARLHYRLVDTASAFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSF
GVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRD
ANSVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHV
LINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQF
RIDPDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWD
FYQGSIFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRR
LDRENVAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVG
SVVAKIRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRREYVLVVQ
ATSAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNNFPTGVIGRIPAHDPDVS
DSLNYTFLQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRV
TIITDDMLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSS
NILNVTFSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENY
MKCVSVLRFDSSAPFLSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGAN
GRCRSREGGYTCECFQDFTGRC
Download sequence
Identical sequences ENSMMUP00000027627 ENSMMUP00000027627 9544.ENSMMUP00000027627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]