SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000027709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000027709
Domain Number 1 Region: 390-436
Classification Level Classification E-value
Superfamily UBA-like 4.08e-17
Family UBA domain 0.00015
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily RING/U-box 8.59e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000308
Family PB1 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000027709
Sequence length 440
Comment (Macaca mulatta)
Sequence
MASLTVKAYLLGKEDAAREIRRFSFCFSPEPEAEAEDAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHQGHTKLAFPSPFGHLSEGFS
HSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDARPGPTAESAAGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPASPESSSTEKNSSQPSSCCSDPSKPGGNVE
GATQSLAEQMRKIALESEGRPEASLDSDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPES
EGPSSLDPSQEGPTGLKEAALYPHLPPGKADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHSPPL
Download sequence
Identical sequences 9544.ENSMMUP00000027709 ENSMMUP00000027709 ENSMMUP00000027709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]