SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000028315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000028315
Domain Number 1 Region: 54-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000334
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000028315
Sequence length 329
Comment (Macaca mulatta)
Sequence
MASRCSEPDPEVSGVPTARGCNGSSLSGALSCCEDSAQGSGQPKALTVAEGPSSCLRRNV
ISERERRKRISLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAMLAS
SKEMWHSLQEDVLQLTLSSQIPAGVPDSGTGASGGTRTPDVKAFLESPWSRDPASAGPEP
LPHVLESSRHWDPPSCTSLGTDKCEVLSGLCQVRGGPPPFSEPSSLVPWPPGPSLPKAVR
PPLSWPPFSQQQTLPMMSGEAPGWLGQAGPLAMGAVPLGEPAEEAPMPVQDARSVLGSDM
EDGTSFLLTAGPSWWPGEWGPGSGAGHLT
Download sequence
Identical sequences ENSMMUP00000028315 ENSMMUP00000028315 9544.ENSMMUP00000028315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]