SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000028520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000028520
Domain Number 1 Region: 457-533
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 2.62e-29
Family VHP, Villin headpiece domain 0.00000718
Further Details:      
 
Domain Number 2 Region: 27-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.46e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 86-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000649
Family LIM domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1-26
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000011
Family LIM domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000028520
Sequence length 533
Comment (Macaca mulatta)
Sequence
CAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGIKC
ETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKK
LKHRRTSETSISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYE
PHSRYTSDEMLERCGYGESLGTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPT
FSRSPHHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPKHFHIPAGDSNIYRKPPIYKRH
GDLSTATKSKTSEDISQTSKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDD
FDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRS
HYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTT
RGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF
Download sequence
Identical sequences 9544.ENSMMUP00000028520 ENSMMUP00000028521 ENSMMUP00000028520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]