SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000028924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000028924
Domain Number 1 Region: 349-485
Classification Level Classification E-value
Superfamily TIMP-like 1.77e-23
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 
Domain Number 2 Region: 128-224
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-21
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 300-356
Classification Level Classification E-value
Superfamily BPTI-like 6.1e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 4 Region: 48-99
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000887
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 250-296
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000922
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000028924
Sequence length 492
Comment (Macaca mulatta)
Sequence
QDCATAEKCCTNVCGLQSCVAARFPDSPAAPTTAASCEGFACPQQGSDCDIWDGQPVCRC
RDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGPPETTAR
PTPGAAPMPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQM
YGNVVVTSIGQLVLYNARLEDAGLYTCTARNAAGLLRADFPLSVVQREPARDRAPSIPAP
AECLPDVQACTGPTSPHLVLWHFDPQRGSCMTFPARGCDGAARGFETYEACQQACARGPG
DACVLPAVQGPCQGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVPRTPP
CRACRLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGLKFLGTK
YLEVTLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDASSYVRAASEKRVKKILELLE
KQACELLNRFQD
Download sequence
Identical sequences ENSMMUP00000028924 ENSMMUP00000028924 9544.ENSMMUP00000028924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]