SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029459
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily NTF2-like 2.71e-48
Family NTF2-like 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029459
Sequence length 140
Comment (Macaca mulatta)
Sequence
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
Download sequence
Identical sequences A0A096NVS4 A0A0D9SBG1 A0A2K5H7K4 A0A2K5KZB6 A0A2K5XU18 A0A2K6B5J3 A0A2K6K099 A0A2K6NRL0 F6YYV6 G3R9X8 G7PH42 H2P170 H2QK26 Q9UKK6
gi|7019471|ref|NP_037380.1| ENSGGOP00000012226 ENSGGOP00000012226 ENSP00000254998 ENSPTRP00000022835 ENSP00000254998 ENSPTRP00000022835 NP_001181092.1.72884 NP_037380.1.87134 NP_037380.1.92137 XP_001146071.2.37143 XP_001146149.1.37143 XP_002830064.1.23681 XP_003829425.2.60992 XP_004061941.1.27298 XP_005568244.1.63531 XP_007959966.1.81039 XP_010367392.1.97406 XP_011527532.1.92137 XP_011748128.1.29376 XP_011818755.1.43180 XP_011827704.1.47321 XP_011907288.1.92194 XP_015005079.1.72884 XP_017715595.1.44346 cath|current|1jkgA00/2-140 cath|current|1jn5A00/4-139 ENSMMUP00000029459 ENSMMUP00000029459 1jkg_A 1jn5_A ENSP00000254998 ENSPPYP00000012029 9544.ENSMMUP00000029459 9598.ENSPTRP00000022835 9600.ENSPPYP00000012029 9606.ENSP00000254998 1jkgA ENSPPYP00000012029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]