SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029475
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.56e-17
Family THAP domain 0.00062
Further Details:      
 
Domain Number 2 Region: 249-529,581-729
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000144
Family Hermes transposase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029475
Sequence length 761
Comment (Macaca mulatta)
Sequence
MPNFCAAPNCTRKSTQSDSAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYPLCAK
HFETSMICRTSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKID
ETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILALTLEEKENKEYLKSLFEILILMGKQN
IPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLE
ICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYE
ADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCS
SCALNTWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELK
EICHSHWTGRHDAFEILVELLQALVLCLDGINSDTNVRWNNCIAGRAFVLCSAVTDFDFI
VTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEAT
NLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLK
ALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPS
TIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNL
ALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Download sequence
Identical sequences ENSMMUP00000029475 9544.ENSMMUP00000029475 ENSMMUP00000029475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]