SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029814
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily TROVE domain-like 5.49e-71
Family TROVE domain-like 0.0000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029814
Sequence length 205
Comment (Macaca mulatta)
Sequence
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKLFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGKHKIFIGNKGG
Download sequence
Identical sequences ENSMMUP00000029814 9544.ENSMMUP00000029814 ENSMMUP00000029814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]