SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029917
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 679-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 455-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-24
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 567-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 720-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 3-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 288-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000157
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000535
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029917
Sequence length 802
Comment (Macaca mulatta)
Sequence
KLYKEAVTFNDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHQPFKQDVSPIER
NEQLWIVTTATQRQRNLGEKNQSKLVTIQDRESEEELSCWQIWQQIANDLTRCQDSMINN
SQFHKQGDFPCQVGAELSVQISEDENYTVNKADGPSDTGNPEFPILRTQDSWRKTFLTES
QRLNRDQQISIKNKLCQCKKGVDPISWISHHDGHRVHKSDKSYRPNDYKKDNMKISTFDQ
NSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKV
HVGEKLKCDECGKEFSQGTHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNLHCKVHTGEK
PYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKC
EECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCG
KGFTLSSNLQAHQRVHTGEKPYKCSECGKSFRRNSHYQVHLVVHTGEKPHKCEICGKGFS
QSSYLQIHQKAHSVEKPFKCEECGQGFNQSSRLQIHQLIHKGEKPYKCEECGKGFSRRAD
LKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAH
QKVHTGEKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVH
TGEKPYKCDMCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTIHHRIHVGDK
SYKNNRGGKNIRESTQEKKSIK
Download sequence
Identical sequences ENSMMUP00000029918 ENSMMUP00000029917 9544.ENSMMUP00000029917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]