SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029927
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.62e-37
Family SCAN domain 0.000064
Further Details:      
 
Domain Number 2 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 224-259
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000131
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029927
Sequence length 545
Comment (Macaca mulatta)
Sequence
MLKEHPEMAEAPQQQLGVPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPREFYTWIREHGPESGKALAAIVEDL
TERALEAKAVPCHGQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPNPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPTMNSRDQEMAAGFFTAGPQGLGPFKDMALAFP
EEEWRHVTPAQIDCFGEYVEPQHCRVCPGGGSKEKEAKPPQEDLKGALAALTSERFGEAT
LQGPGLGRACEQEPGGSAGSAPGLPPPQHGAIPLPDEVKTHSSFWKPFQCPECGKGFSRS
SNLVRHQRTHEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLE
VHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRA
HTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQ
EPLVQ
Download sequence
Identical sequences A0A2K5WR53 F7GIA5
NP_001244384.1.72884 XP_005549237.1.63531 XP_005549239.1.63531 XP_014989805.1.72884 XP_014989806.1.72884 XP_014989808.1.72884 XP_015302603.1.63531 9544.ENSMMUP00000029927 ENSMMUP00000029927 ENSMMUP00000029927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]