SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000029949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000029949
Domain Number 1 Region: 432-567
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-31
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 385-437
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 324-380
Classification Level Classification E-value
Superfamily BPTI-like 6.53e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 5 Region: 123-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000132
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 37-88
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000902
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000029949
Sequence length 576
Comment (Macaca mulatta)
Sequence
MWALRCRPFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECQTDQECEAYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQG
SECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFT
WPNTSPPPPETTMHPTTASPETPELDMAAPALLNHPVHQSVTMGETVSFLCDVVGRPRPE
ITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNAAGVLRADF
PLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGH
CHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGR
ALVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVTVSETPLIIMGEVDGGMAML
RPDSFVGVSSARRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences F7GFJ7
XP_001100200.1.72884 9544.ENSMMUP00000029949 ENSMMUP00000029949 ENSMMUP00000029949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]