SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000030054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000030054
Domain Number 1 Region: 21-112
Classification Level Classification E-value
Superfamily Immunoglobulin 6.89e-30
Family V set domains (antibody variable domain-like) 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000030054
Sequence length 112
Comment (Macaca mulatta)
Sequence
MLWVPVTLPSSVTIPGTSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWY
LQKPGQSPQLLIYEVSKRASGVPERFSGSGSDTDFTLKINLVEAEDVGVYYC
Download sequence
Identical sequences ENSMMUP00000030054 ENSMMUP00000030054 9544.ENSMMUP00000030054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]