SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000030492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000030492
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 489-619
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.54e-31
Family Ricin B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000030492
Sequence length 619
Comment (Macaca mulatta)
Sequence
MRLLRRHHTPLRLAIVGCTFVFFLFLLHRDVSNREEATEKPWLKSLVSRKDHVLDIMLEA
MNNLRDSMPKLQIRAPEAQPTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAF
QKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVKV
VRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT
IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHSFSWY
LHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELTQDQLIRNSGSGTCLTS
QDKKPAMAPCNPNDPHQLW
Download sequence
Identical sequences ENSMMUP00000030492 9544.ENSMMUP00000030492 ENSMMUP00000030492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]