SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000032002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000032002
Domain Number 1 Region: 35-101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000032002
Sequence length 128
Comment (Macaca mulatta)
Sequence
XGFAPHPAALGPPTLLAEQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRA
KTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAAQGP
PNLPGQTT
Download sequence
Identical sequences 9544.ENSMMUP00000032002 ENSMMUP00000032002 ENSMMUP00000032002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]