SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000034279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000034279
Domain Number 1 Region: 4-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000461
Family Erythroid transcription factor GATA-1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000034279
Sequence length 271
Comment (Macaca mulatta)
Sequence
MPLGLKPTCSVCKTTSSSMWKKGTQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSSGGGG
GFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRR
HIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQY
CEKSAALTWLIPTLSSPRDQFDPASYIIGNEEDLPRKMEYLEFVCHAPSEYFKSRSSPFP
TVPTRPEKGYIWTHVGPTPAITIKETVANHL
Download sequence
Identical sequences ENSMMUP00000034279 9544.ENSMMUP00000034279 ENSMMUP00000034279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]